PDB entry 1h73

View 1h73 on RCSB PDB site
Description: crystal structure of homoserine kinase complexed with threonine
Class: transferase
Keywords: transferase, kinase, threonine biosynthesis
Deposited on 2001-07-02, released 2001-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: homoserine kinase
    Species: Methanococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h73a1, d1h73a2
  • Heterogens: THR, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h73A (A:)
mkvrvkapctsanlgvgfdvfglclkepydvieveaiddkeiiievddkniptdpdknva
givakkmiddfnigkgvkitikkgvkagsglgssaassagtayainelfklnldklklvd
yasygelassgakhadnvapaifggftmvtnyeplevlhipidfkldiliaipnisintk
eareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymmsdkviepvrgklipnyfk
ikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyentirtevgkgvevv