PDB entry 1h72

View 1h72 on RCSB PDB site
Description: crystal structure of homoserine kinase complexed with hse
Deposited on 2001-07-02, released 2001-09-13
The last revision prior to the SCOP 1.61 freeze date was dated 2001-09-13, with a file datestamp of 2001-09-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h72C (C:)
    mkvrvkapctsanlgvgfdvfglclkepydvieveaiddkeiiievddkniptdpdknva
    givakkmiddfnigkgvkitikkgvkagsglgssaassagtayainelfklnldklklvd
    yasygelassgakhadnvapaifggftmvtnyeplevlhipidfkldiliaipnisintk
    eareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymmsdkviepvrgklipnyfk
    ikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyentirtevgkgvevv