PDB entry 1h70

View 1h70 on RCSB PDB site
Description: ddah from pseudomonas aeruginosa. c249s mutant complexed with citrulline
Class: hydrolase
Keywords: hydrolase, ddah, nitric oxide synthase inhibitor
Deposited on 2001-06-30, released 2001-08-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ng, ng-dimethylarginine dimethylaminohydrolase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H70 (0-0)
      • engineered mutation (249)
    • Uniprot Q9I4E3 (1-254)
    Domains in SCOPe 2.08: d1h70a_
  • Heterogens: CIR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h70A (A:)
    fmfkhiiartparslvdgltsshlgkpdyakaleqhnayiralqtcdvditllppderfp
    dsvfvedpvlctsrcaiitrpgaesrrgeteiieetvqrfypgkverieapgtveagdim
    mvgdhfyigesartnaegarqmiailekhglsgsvvrlekvlhlktglaylehnnllaag
    efvskpefqdfniieipeeesyaanciwvnervimpagyprtrekiarlgyrvievdtse
    yrkidggvssmslrf