PDB entry 1h6x

View 1h6x on RCSB PDB site
Description: the role of conserved amino acids in the cleft of the c-terminal family 22 carbohydrate binding module of clostridium thermocellum xyn10b in ligand binding
Class: hydrolase
Keywords: xylan degradation, hydrolase, glycosidase
Deposited on 2001-06-29, released 2002-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.214
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase y
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51584
      • engineered mutation (24)
    Domains in SCOPe 2.08: d1h6xa1, d1h6xa2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1h6xA (A:)
meepdangyyyhdtfegsvgqwtaagpaevllsgrtaykgsesllvrnrtaawngaqral
nprtfvpgntycfsvvasfiegassttfcmklqyvdgsgtqrydtidmktvgpnqwvhly
npqyripsdatdmyvyvetaddtinfyideaigavagtvieglehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1h6xA (A:)
epdangyyyhdtfegsvgqwtaagpaevllsgrtaykgsesllvrnrtaawngaqralnp
rtfvpgntycfsvvasfiegassttfcmklqyvdgsgtqrydtidmktvgpnqwvhlynp
qyripsdatdmyvyvetaddtinfyideaigavagtvie