PDB entry 1h6t

View 1h6t on RCSB PDB site
Description: internalin b: crystal structure of fused n-terminal domains.
Class: cell adhesion
Keywords: cell adhesion, leucine rich repeat, ig-like domain, ef-hand domain
Deposited on 2001-06-22, released 2001-10-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.165
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: internalin b
    Species: LISTERIA MONOCYTOGENES [TaxId:1639]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H6T (0-4)
    • Uniprot P25147 (5-290)
    Domains in SCOPe 2.06: d1h6ta1, d1h6ta2, d1h6ta3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h6tA (A:)
    gplgsetitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiks
    vqgiqylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslsle
    hngisdinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltkl
    qnlylsknhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpe
    iisddgdyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplke