PDB entry 1h6p

View 1h6p on RCSB PDB site
Description: Dimeristion domain from human TRF2
Class: telomere binding
Keywords: telomere binding, trf2, telomere, dimerisation, trfh, DNA-binding, nuclear protein
Deposited on 2001-06-20, released 2001-09-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: telomeric repeat binding factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1h6pa_
  • Chain 'B':
    Compound: telomeric repeat binding factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1h6pb_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h6pA (A:)
    agearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrllr
    vmqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaav
    iiciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkml
    rfleshlddaepylltmakkalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6pA (A:)
    agearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgvsrllrvmqc
    lsrieegenlsfdmeaeltplesainvlemikteftlteavvessrklvkeaaviicikn
    kefekaskilkkhmrndllniireknlahpviqnfsyetfqqkmlrfleshlddaepyll
    tmakkalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h6pB (B:)
    agearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrllr
    vmqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaav
    iiciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkml
    rfleshlddaepylltmakkalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6pB (B:)
    earleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrllrvm
    qclsrieegensfdmeaeltplesainvlemikteftlteavvessrklvkeaaviicik
    nkefekaskilkkhmrndllniireknlahpviqnfsyetfqqkmlrfleshlddaepyl
    ltmakkal