PDB entry 1h6m

View 1h6m on RCSB PDB site
Description: covalent glycosyl-enzyme intermediate of hen egg white lysozyme
Class: hydrolase
Keywords: hydrolase, glycoside hydrolase, covalent intermediate
Deposited on 2001-06-19, released 2001-08-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.172
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • engineered mutation (34)
    Domains in SCOPe 2.03: d1h6ma_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h6mA (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfqsnfntqatnrntdgstdygilqins
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl