PDB entry 1h6m

View 1h6m on RCSB PDB site
Description:
Deposited on 2001-06-19, released 2001-08-30
The last revision prior to the SCOP 1.63 freeze date was dated 2001-08-30, with a file datestamp of 2001-08-30.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.17209
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1h6ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h6mA (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfqsnfntqatnrntdgstdygilqins
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl