PDB entry 1h6j

View 1h6j on RCSB PDB site
Description: the three-dimensional structure of capsule-specific cmp:2-keto-3-deoxy-manno-octonic acid synthetase from escherichia coli
Class: nucleotidyltransferase
Keywords: nucleotidyltransferase, cmp-kdo synthetase, capsular polysaccharide, saccharide activation
Deposited on 2001-06-17, released 2001-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.225
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-deoxy-manno-octulosonate cytidylyltransferase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h6ja_
  • Chain 'B':
    Compound: 3-deoxy-manno-octulosonate cytidylyltransferase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h6jb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h6jA (A:)
    skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
    afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
    pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
    dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
    laena
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6jA (A:)
    skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
    afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
    pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
    dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
    l
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h6jB (B:)
    skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
    afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
    pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
    dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
    laena
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6jB (B:)
    skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
    afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
    pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
    dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
    l