PDB entry 1h6h

View 1h6h on RCSB PDB site
Description: structure of the px domain from p40phox bound to phosphatidylinositol 3-phosphate
Deposited on 2001-06-15, released 2001-11-01
The last revision prior to the SCOP 1.59 freeze date was dated 2001-11-01, with a file datestamp of 2001-11-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.196
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1h6ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h6hA (A:)
avaqqlraesdfeqlpddvaisaniadieekrgftshfvfvievktkggskyliyrryrq
fhalqskleerfgpdskssalactlptlpakvyvgvkqeiaemripalnaymksllslpv
wvlmdedvriffyqspydseqvp