PDB entry 1h6g

View 1h6g on RCSB PDB site
Description: alpha-catenin M-domain
Class: cell adhesion
Keywords: alpha-catenin, adhesion modulation, cytoskeleton, cell adhesion
Deposited on 2001-06-14, released 2001-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-10, with a file datestamp of 2016-02-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-1 catenin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h6ga1, d1h6ga2
  • Chain 'B':
    Compound: alpha-1 catenin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h6gb1, d1h6gb2
  • Heterogens: MPD, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h6gA (A:)
    dlrrqlrkavmdhvsdsfletnvpllvlieaakngnekevkeyaqvfrehanklievanl
    acsisnneegvklvrmsasqlealcpqvinaalalaakpqsklaqenmdlfkeqwekqvr
    vltdavdditsiddflavsenhiledvnkcvialqekdvdgldrtagairgraarvihvv
    tsemdnyepgvytekvleatkllsntvmprfteqveaavealssdpaqpmdenefidasr
    lvydgirdirkavlmi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6gA (A:)
    dlrrqlrkavmdhvsdsfletnvpllvlieaakngnekevkeyaqvfrehanklievanl
    acsisnneegvklvrmsasqlealcpqvinaalalaakpqsklaqenmdlfkeqwekqvr
    vltdavdditsiddflavsenhiledvnkcvialqekdvdgldrtagairgraarvihvv
    tsemdnyepgvytekvleatkllsntvmprfteqveaavealssdpaqpmdenefidasr
    lvydgirdirkavlm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h6gB (B:)
    dlrrqlrkavmdhvsdsfletnvpllvlieaakngnekevkeyaqvfrehanklievanl
    acsisnneegvklvrmsasqlealcpqvinaalalaakpqsklaqenmdlfkeqwekqvr
    vltdavdditsiddflavsenhiledvnkcvialqekdvdgldrtagairgraarvihvv
    tsemdnyepgvytekvleatkllsntvmprfteqveaavealssdpaqpmdenefidasr
    lvydgirdirkavlmi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6gB (B:)
    dsfletnvpllvlieaakngnekevkeyaqvfrehanklievanlacsisnneegvklvr
    msasqlealcpqvinaalalaakpqsklaqenmdlfkeqwekqvrvltdavdditsiddf
    lavsenhiledvnkcvialqekdvdgldrtagairgraarvihvvtsemdnyepgvytek
    vleatkllsntvmprfteqveaavealssdpaqpmdenefidasrlvydgirdirkavlm
    i