SCOPe 2.05: Structural Classification of Proteins

PDB entry 1h6d

View 1h6d on RCSB PDB site
Description: oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol
Class: protein translocation
Keywords: protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding, crystal structure
Deposited on 2001-06-12, released 2001-11-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.197
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: precursor form of glucose-fructose oxidoreductase
Species: Zymomonas mobilis [TaxId:542]
Database cross-references and differences (RAF-indexed):
- Uniprot P75002 (Start-432)
Domains in SCOPe 2.05: d1h6da1, d1h6da2
Chain 'B':
Compound: precursor form of glucose-fructose oxidoreductase
Species: Zymomonas mobilis [TaxId:542]
Database cross-references and differences (RAF-indexed):
- Uniprot P75002 (Start-432)
Domains in SCOPe 2.05: d1h6db1, d1h6db2
Chain 'C':
Compound: precursor form of glucose-fructose oxidoreductase
Species: Zymomonas mobilis [TaxId:542]
Database cross-references and differences (RAF-indexed):
- Uniprot P75002 (Start-432)
Domains in SCOPe 2.05: d1h6dc1, d1h6dc2
Chain 'D':
Compound: precursor form of glucose-fructose oxidoreductase
Species: Zymomonas mobilis [TaxId:542]
Database cross-references and differences (RAF-indexed):
- Uniprot P75002 (Start-432)
Domains in SCOPe 2.05: d1h6dd1, d1h6dd2
Chain 'E':
Compound: precursor form of glucose-fructose oxidoreductase
Species: Zymomonas mobilis [TaxId:542]
Database cross-references and differences (RAF-indexed):
- Uniprot P75002 (Start-432)
Domains in SCOPe 2.05: d1h6de1, d1h6de2
Chain 'F':
Compound: precursor form of glucose-fructose oxidoreductase
Species: Zymomonas mobilis [TaxId:542]
Database cross-references and differences (RAF-indexed):
- Uniprot P75002 (Start-432)
Domains in SCOPe 2.05: d1h6df1, d1h6df2
Chain 'G':
Compound: precursor form of glucose-fructose oxidoreductase
Species: Zymomonas mobilis [TaxId:542]
Database cross-references and differences (RAF-indexed):
- Uniprot P75002 (Start-432)
Domains in SCOPe 2.05: d1h6dg1, d1h6dg2
Chain 'H':
Compound: precursor form of glucose-fructose oxidoreductase
Species: Zymomonas mobilis [TaxId:542]
Database cross-references and differences (RAF-indexed):
- Uniprot P75002 (Start-432)
Domains in SCOPe 2.05: d1h6dh1, d1h6dh2
Chain 'I':
Compound: precursor form of glucose-fructose oxidoreductase
Species: Zymomonas mobilis [TaxId:542]
Database cross-references and differences (RAF-indexed):
- Uniprot P75002 (Start-432)
Domains in SCOPe 2.05: d1h6di1, d1h6di2
Chain 'J':
Compound: precursor form of glucose-fructose oxidoreductase
Species: Zymomonas mobilis [TaxId:542]
Database cross-references and differences (RAF-indexed):
- Uniprot P75002 (Start-432)
Domains in SCOPe 2.05: d1h6dj1, d1h6dj2
Chain 'K':
Compound: precursor form of glucose-fructose oxidoreductase
Species: Zymomonas mobilis [TaxId:542]
Database cross-references and differences (RAF-indexed):
- Uniprot P75002 (Start-432)
Domains in SCOPe 2.05: d1h6dk1, d1h6dk2
Chain 'L':
Compound: precursor form of glucose-fructose oxidoreductase
Species: Zymomonas mobilis [TaxId:542]
Database cross-references and differences (RAF-indexed):
- Uniprot P75002 (Start-432)
Domains in SCOPe 2.05: d1h6dl1, d1h6dl2
Heterogens: NDP, GOL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1h6dA (A:)
mtnkisssdnlsnavsatddnasrtpnlnrralvgggvglaargalasglqaatlpagas
qvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsriealvsgnae
kakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafkagkhvmce
kpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklgmvttdnsd
vmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysdpnderfve
vedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnlisvqtpgh
anqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrp
vntdwgyvrqggy