PDB entry 1h6b

View 1h6b on RCSB PDB site
Description: reduced precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol
Class: protein translocation
Keywords: protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding, crystal structure
Deposited on 2001-06-11, released 2001-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: precursor form of glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h6ba1, d1h6ba2
  • Chain 'B':
    Compound: precursor form of glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h6bb1, d1h6bb2
  • Heterogens: NDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h6bA (A:)
    mtnkisssdnlsnavsatddnasrtpnlnrralvgggvglaargalasglqaatlpagas
    qvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsriealvsgnae
    kakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafkagkhvmce
    kpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklgmvttdnsd
    vmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysdpnderfve
    vedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnlisvqtpgh
    anqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrp
    vntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6bA (A:)
    atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
    alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
    agkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklg
    mvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysd
    pnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnl
    isvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiy
    eaartgrpvntdwgyvrqggy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h6bB (B:)
    mtnkisssdnlsnavsatddnasrtpnlnrralvgggvglaargalasglqaatlpagas
    qvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsriealvsgnae
    kakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafkagkhvmce
    kpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklgmvttdnsd
    vmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysdpnderfve
    vedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnlisvqtpgh
    anqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrp
    vntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6bB (B:)
    atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
    alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
    agkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklg
    mvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysd
    pnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnl
    isvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiy
    eaartgrpvntdwgyvrqggy