PDB entry 1h6a

View 1h6a on RCSB PDB site
Description: reduced precursor form of glucose-fructose oxidoreductase from zymomonas mobilis
Deposited on 2001-06-11, released 2001-11-28
The last revision prior to the SCOP 1.59 freeze date was dated 2001-11-28, with a file datestamp of 2001-11-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.204
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h6aA (A:)
    atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
    alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
    agkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklg
    mvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysd
    pnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnl
    isvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiy
    eaartgrpvntdwgyvrqggy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h6aB (B:)
    atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
    alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
    agkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklg
    mvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysd
    pnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnl
    isvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiy
    eaartgrpvntdwgyvrqggy