PDB entry 1h67

View 1h67 on RCSB PDB site
Description: nmr structure of the ch domain of calponin
Class: cytoskeleton
Keywords: cytoskeleton, calponin homology domain, actin binding, nmr
Deposited on 2001-06-07, released 2002-02-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calponin alpha
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PSG0 (0-107)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1h67a1, d1h67a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h67A (A:)
    mpqterqlrvwiegatgrrigdnfmdglkdgvilcelinklqpgsvqkvndpvqnwhkle
    nignflraikhygvkphdifeandlfentnhtqvqstlialasqaktk