PDB entry 1h67

View 1h67 on RCSB PDB site
Description: NMR Structure of the CH Domain of Calponin
Class: cytoskeleton
Keywords: cytoskeleton, calponin homology domain, actin binding
Deposited on 2001-06-07, released 2002-02-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calponin alpha
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9PSG0 (0-107)
    • cloning artifact (0)
  Domains in SCOPe 2.08: d1h67a1, d1h67a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1h67A (A:)
  mpqterqlrvwiegatgrrigdnfmdglkdgvilcelinklqpgsvqkvndpvqnwhkle
  nignflraikhygvkphdifeandlfentnhtqvqstlialasqaktk