PDB entry 1h66

View 1h66 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF HUMAN NAD[P]H-QUINONE OXIDOREDUCTASE CO WITH 2,5-diaziridinyl-3-hydroxyl-6-methyl-1,4-benzoquinone
Class: oxidoreductase
Keywords: flavoprotein, rossmann fold, oxidoreductase
Deposited on 2001-06-06, released 2001-09-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.256
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad(p)h dehydrogenase [quinone] 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15559 (0-272)
      • conflict (0)
    Domains in SCOPe 2.06: d1h66a_
  • Chain 'B':
    Compound: nad(p)h dehydrogenase [quinone] 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15559 (0-272)
      • conflict (0)
    Domains in SCOPe 2.06: d1h66b_
  • Chain 'C':
    Compound: nad(p)h dehydrogenase [quinone] 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15559 (0-272)
      • conflict (0)
    Domains in SCOPe 2.06: d1h66c_
  • Chain 'D':
    Compound: nad(p)h dehydrogenase [quinone] 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15559 (0-272)
      • conflict (0)
    Domains in SCOPe 2.06: d1h66d_
  • Heterogens: RH1, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h66A (A:)
    agrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklk
    dpanfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervf
    igefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcg
    fqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkk
    evqdeeknkkfglsvghhlgksiptdnqikark
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h66B (B:)
    agrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklk
    dpanfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervf
    igefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcg
    fqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkk
    evqdeeknkkfglsvghhlgksiptdnqikark
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h66C (C:)
    agrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklk
    dpanfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervf
    igefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcg
    fqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkk
    evqdeeknkkfglsvghhlgksiptdnqikark
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h66D (D:)
    agrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklk
    dpanfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervf
    igefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcg
    fqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkk
    evqdeeknkkfglsvghhlgksiptdnqikark