PDB entry 1h5o

View 1h5o on RCSB PDB site
Description: Solution structure of Crotamine, a neurotoxin from Crotalus durissus terrificus
Deposited on 2001-05-23, released 2003-05-09
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-09, with a file datestamp of 2003-05-09.
Experiment type: MR,26STRUCTURES
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1h5oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h5oA (A:)
    ykqchkkgghcfpkekiclppssdfgkmdcrwrwkcckkgsg