PDB entry 1h5n

View 1h5n on RCSB PDB site
Description: dmso reductase modified by the presence of dms and air
Class: oxidoreductase
Keywords: oxidoreductase, reductase, dmso, dms, molybdopterin
Deposited on 2001-05-22, released 2002-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.158
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dmso reductase
    Species: Rhodobacter capsulatus [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q52675 (Start-822)
      • sequenced from map (80)
      • sequenced from map (84)
      • sequenced from map (148)
      • sequenced from map (275)
      • sequenced from map (277)
      • sequenced from map (321)
      • sequenced from map (335-336)
      • sequenced from map (353)
      • sequenced from map (415)
      • sequenced from map (497)
      • sequenced from map (567)
      • sequenced from map (596)
    Domains in SCOPe 2.07: d1h5na1, d1h5na2
  • Chain 'C':
    Compound: dmso reductase
    Species: Rhodobacter capsulatus [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q52675 (Start-822)
      • sequenced from map (80)
      • sequenced from map (84)
      • sequenced from map (148)
      • sequenced from map (275)
      • sequenced from map (277)
      • sequenced from map (321)
      • sequenced from map (335-336)
      • sequenced from map (353)
      • sequenced from map (415)
      • sequenced from map (497)
      • sequenced from map (567)
      • sequenced from map (596)
    Domains in SCOPe 2.07: d1h5nc1, d1h5nc2
  • Heterogens: PGD, 6MO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h5nA (A:)
    mtkfsgnelraelyrraflsysvapgalgmfgrsllakgaraealangtvmsgshwgvft
    atvengrataftpwekdphpspmlagvldsiysptrikypmvrreflekgvnadrstrgn
    gdfvrvswdqaldlvaaevkrveetygpegvfggsygwkspgrlhncttllrrmltlagg
    yvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmvfwaadpiktsqigwvi
    pehgaypglealkakgtkvividpvrtktveffgaehitpkpqtdvaimlgmahtlvaed
    lydkdfianytsgfdkflpyldgetdstpktaewaegisgvpaetikelarlfeskrtml
    aagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysgggtpstsgpalagitd
    ggaatkgpewlaasgasvipvarvvdmlenpgaefdfngtrskfpdvkmaywvggnpfvh
    hqdrnrmvkawekletfvvhdfqwtptarhadivlpattsyerndietigdysntgilam
    kkiveplyearsdydifaavaerlgkgaeftegkdemgwiksfyddaakqgkaagvqmpa
    fdafwaegivefpvtdgadfvryasfredpllnplgtptglieiyskniekmgyddcpah
    ptwmeplerldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpddaaa
    rgiadgdvvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygdvnv
    lsadigtsklaqgncgqtvlaevekytgpavtltgfvapkaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h5nA (A:)
    angtvmsgshwgvftatvengrataftpwekdphpspmlagvldsiysptrikypmvrre
    flekgvnadrstrgngdfvrvswdqaldlvaaevkrveetygpegvfggsygwkspgrlh
    ncttllrrmltlaggyvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmvf
    waadpiktsqigwvipehgaypglealkakgtkvividpvrtktveffgaehitpkpqtd
    vaimlgmahtlvaedlydkdfianytsgfdkflpyldgetdstpktaewaegisgvpaet
    ikelarlfeskrtmlaagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysgg
    gtpstsgpalagitdggasvipvarvvdmlenpgaefdfngtrskfpdvkmaywvggnpf
    vhhqdrnrmvkawekletfvvhdfqwtptarhadivlpattsyerndietigdysntgil
    amkkiveplyearsdydifaavaerlgkgaeftegkdemgwiksfyddaakqgkaagvqm
    pafdafwaegivefpvtdgadfvryasfredpllnplgtptglieiyskniekmgyddcp
    ahptwmeplerldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpdda
    aargiadgdvvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygdv
    nvlsadigtsklaqgncgqtvlaevekytgpavtltgfvapkaae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1h5nC (C:)
    mtkfsgnelraelyrraflsysvapgalgmfgrsllakgaraealangtvmsgshwgvft
    atvengrataftpwekdphpspmlagvldsiysptrikypmvrreflekgvnadrstrgn
    gdfvrvswdqaldlvaaevkrveetygpegvfggsygwkspgrlhncttllrrmltlagg
    yvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmvfwaadpiktsqigwvi
    pehgaypglealkakgtkvividpvrtktveffgaehitpkpqtdvaimlgmahtlvaed
    lydkdfianytsgfdkflpyldgetdstpktaewaegisgvpaetikelarlfeskrtml
    aagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysgggtpstsgpalagitd
    ggaatkgpewlaasgasvipvarvvdmlenpgaefdfngtrskfpdvkmaywvggnpfvh
    hqdrnrmvkawekletfvvhdfqwtptarhadivlpattsyerndietigdysntgilam
    kkiveplyearsdydifaavaerlgkgaeftegkdemgwiksfyddaakqgkaagvqmpa
    fdafwaegivefpvtdgadfvryasfredpllnplgtptglieiyskniekmgyddcpah
    ptwmeplerldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpddaaa
    rgiadgdvvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygdvnv
    lsadigtsklaqgncgqtvlaevekytgpavtltgfvapkaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h5nC (C:)
    langtvmsgshwgvftatvengrataftpwekdphpspmlagvldsiysptrikypmvrr
    eflekgvnadrstrgngdfvrvswdqaldlvaaevkrveetygpegvfggsygwkspgrl
    hncttllrrmltlaggyvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmv
    fwaadpiktsqigwvipehgaypglealkakgtkvividpvrtktveffgaehitpkpqt
    dvaimlgmahtlvaedlydkdfianytsgfdkflpyldgetdstpktaewaegisgvpae
    tikelarlfeskrtmlaagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysg
    ggtpstsgpalagitdggasvipvarvvdmlenpgaefdfngtrskfpdvkmaywvggnp
    fvhhqdrnrmvkawekletfvvhdfqwtptarhadivlpattsyerndietigdysntgi
    lamkkiveplyearsdydifaavaerlgkgaeftegkdemgwiksfyddaakqgkaagvq
    mpafdafwaegivefpvtdgadfvryasfredpllnplgtptglieiyskniekmgyddc
    pahptwmeplerldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpdd
    aaargiadgdvvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygd
    vnvlsadigtsklaqgncgqtvlaevekytgpavtltgfvapkaae