PDB entry 1h59

View 1h59 on RCSB PDB site
Description: complex of igfbp-5 with igf-I
Class: insulin
Keywords: insulin, insulin-like growth factor, igf binding protein
Deposited on 2001-05-21, released 2002-05-16
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin-like growth factor ia
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1h59a_
  • Chain 'B':
    Compound: insulin-like growth factor binding protein 5
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24593 (0-End)
      • conflict (0)
    Domains in SCOP 1.75: d1h59b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h59A (A:)
    gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
    caplkpaksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h59A (A:)
    petlcgaelvdalqfvcgdrgfyfnkptgytgivdeccfrscdlrrlemycapl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h59B (B:)
    salaegqscgvytercaqglrclprqdeekplhallhgrgvclneksyreqvki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h59B (B:)
    salaegqscgvytercaqglrclprqdeekplhallhgrgvclne