PDB entry 1h56

View 1h56 on RCSB PDB site
Description: Structural and biochemical characterization of a new magnesium ion binding site near Tyr94 in the restriction endonuclease PvuII
Class: endonuclease
Keywords: endonuclease, type II restriction endonuclease, hydrolase, nuclease,
Deposited on 2001-05-20, released 2003-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type II restriction enzyme pvuii
    Species: Proteus vulgaris [TaxId:585]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1h56a_
  • Chain 'B':
    Compound: type II restriction enzyme pvuii
    Species: Proteus vulgaris [TaxId:585]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1h56b_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h56A (A:)
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h56B (B:)
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy