PDB entry 1h54

View 1h54 on RCSB PDB site
Description: Maltose phosphorylase from Lactobacillus brevis
Deposited on 2001-05-18, released 2001-09-05
The last revision prior to the SCOP 1.57 freeze date was dated 2001-09-05, with a file datestamp of 2001-09-05.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.22
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h54A (A:)
    mkrifevqpwnvithtfdpkdkrlqesmtslgngymgmrgdfeegysgdslqgiylggvw
    ypdktrvgwwkngypkyfgkvvnavnfiklpieingepvdlakdkisdftldldmhqgvl
    nrsfvvergavrvalnfqrflsvaqpelsvqkvtvknlsdaevdvtlkpsidadvmneea
    nyderfwdvlatdqqadrgsivakttpnpfgtprftsgmemrlvtdlknvaitqpnekev
    ttaytgklapqasaelekrvivvtsrdydtqesltaamhqlsdkvaqssyedllnahtai
    waqrweksdvvikgddesqqgirfnlfqlfstyygedarlnigpkgftgekyggatywdt
    eafafpvylgitdpkvtrnllmyrykqldgayinaqeqglkgalfpmvtfdgiechnewe
    itfeeihrngdiafaiynytrytgddsyvlhegakvlteisrfwadrvhfskrnnqymih
    gvtgadeyennvdnnwdtnmlaqwtlkytleilgkvdqdtakqldvsdeektkwqdivdr
    mylpydkdlnifvqhdgfldkdiepvssipadqrpinqnwswdkilrspyikqgdvlqgi
    wdfiddytpeqkkanfdfyepltvhesslspaihsvlaadlhyedkavelysrtarldld
    nynndttdglhitsmtgawiavvqgfagmrvrdgqlhyapflpktwtsytfrqvfrdrli
    evsvhadgphfkllsgepltidvagaaaaaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h54A (A:)
    mkrifevqpwnvithtfdpkdkrlqesmtslgngymgmrgdfeegysgdslqgiylggvw
    ypdktrvgwwkngypkyfgkvvnavnfiklpieingepvdlakdkisdftldldmhqgvl
    nrsfvvergavrvalnfqrflsvaqpelsvqkvtvknlsdaevdvtlkpsidadvmneea
    nydrfwdvlatdqqadrgsivakttpnpfgtprftsgmemrlvtdlknvaitqpnekevt
    taytgklapqasaelekrvivvtsrdydtqesltaamhqlsdkvaqssyedllnahtaiw
    aqrweksdvvikgddesqqgirfnlfqlfstyygedarlnigpkgftgekyggatywdte
    afafpvylgitdpkvtrnllmyrykqldgayinaqeqglkgalfpmvtfdgiechnewei
    tfeeihrngdiafaiynytrytgddsyvlhegakvlteisrfwadrvhfskrnnqymihg
    vtgadeyennvdnnwdtnmlaqwtlkytleilgkvdqdtakqldvsdeektkwqdivdrm
    ylpydkdlnifvqhdgfldkdiepvssipadqrpinqnwswdkilrspyikqgdvlqgiw
    dfiddytpeqkkanfdfyepltvhesslspaihsvlaadlhyedkavelysrtarldldn
    ynndttdglhitsmtgawiavvqgfagmrvrdgqlhyapflpktwtsytfrqvfrdrlie
    vsvhadgphfkllsgepltidvagaaaaaaaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h54B (B:)
    mkrifevqpwnvithtfdpkdkrlqesmtslgngymgmrgdfeegysgdslqgiylggvw
    ypdktrvgwwkngypkyfgkvvnavnfiklpieingepvdlakdkisdftldldmhqgvl
    nrsfvvergavrvalnfqrflsvaqpelsvqkvtvknlsdaevdvtlkpsidadvmneea
    nyderfwdvlatdqqadrgsivakttpnpfgtprftsgmemrlvtdlknvaitqpnekev
    ttaytgklapqasaelekrvivvtsrdydtqesltaamhqlsdkvaqssyedllnahtai
    waqrweksdvvikgddesqqgirfnlfqlfstyygedarlnigpkgftgekyggatywdt
    eafafpvylgitdpkvtrnllmyrykqldgayinaqeqglkgalfpmvtfdgiechnewe
    itfeeihrngdiafaiynytrytgddsyvlhegakvlteisrfwadrvhfskrnnqymih
    gvtgadeyennvdnnwdtnmlaqwtlkytleilgkvdqdtakqldvsdeektkwqdivdr
    mylpydkdlnifvqhdgfldkdiepvssipadqrpinqnwswdkilrspyikqgdvlqgi
    wdfiddytpeqkkanfdfyepltvhesslspaihsvlaadlhyedkavelysrtarldld
    nynndttdglhitsmtgawiavvqgfagmrvrdgqlhyapflpktwtsytfrqvfrdrli
    evsvhadgphfkllsgepltidvagaaaaaaaaa