PDB entry 1h54

View 1h54 on RCSB PDB site
Description: Maltose phosphorylase from Lactobacillus brevis
Class: hydrolase
Keywords: hydrolase, maltose metabolism
Deposited on 2001-05-18, released 2001-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.215
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltose phosphorylase
    Species: LACTOBACILLUS BREVIS [TaxId:1580]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H54 (0-753)
    Domains in SCOPe 2.07: d1h54a1, d1h54a2
  • Chain 'B':
    Compound: maltose phosphorylase
    Species: LACTOBACILLUS BREVIS [TaxId:1580]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H54 (0-753)
    Domains in SCOPe 2.07: d1h54b1, d1h54b2
  • Heterogens: K, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h54A (A:)
    mkrifevqpwnvithtfdpkdkrlqesmtslgngymgmrgdfeegysgdslqgiylggvw
    ypdktrvgwwkngypkyfgkvvnavnfiklpieingepvdlakdkisdftldldmhqgvl
    nrsfvvergavrvalnfqrflsvaqpelsvqkvtvknlsdaevdvtlkpsidadvmneea
    nyderfwdvlatdqqadrgsivakttpnpfgtprftsgmemrlvtdlknvaitqpnekev
    ttaytgklapqasaelekrvivvtsrdydtqesltaamhqlsdkvaqssyedllnahtai
    waqrweksdvvikgddesqqgirfnlfqlfstyygedarlnigpkgftgekyggatywdt
    eafafpvylgitdpkvtrnllmyrykqldgayinaqeqglkgalfpmvtfdgiechnewe
    itfeeihrngdiafaiynytrytgddsyvlhegakvlteisrfwadrvhfskrnnqymih
    gvtgadeyennvdnnwdtnmlaqwtlkytleilgkvdqdtakqldvsdeektkwqdivdr
    mylpydkdlnifvqhdgfldkdiepvssipadqrpinqnwswdkilrspyikqgdvlqgi
    wdfiddytpeqkkanfdfyepltvhesslspaihsvlaadlhyedkavelysrtarldld
    nynndttdglhitsmtgawiavvqgfagmrvrdgqlhyapflpktwtsytfrqvfrdrli
    evsvhadgphfkllsgepltidvagaaaaaaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h54A (A:)
    mkrifevqpwnvithtfdpkdkrlqesmtslgngymgmrgdfeegysgdslqgiylggvw
    ypdktrvgwwkngypkyfgkvvnavnfiklpieingepvdlakdkisdftldldmhqgvl
    nrsfvvergavrvalnfqrflsvaqpelsvqkvtvknlsdaevdvtlkpsidadvmneea
    nydrfwdvlatdqqadrgsivakttpnpfgtprftsgmemrlvtdlknvaitqpnekevt
    taytgklapqasaelekrvivvtsrdydtqesltaamhqlsdkvaqssyedllnahtaiw
    aqrweksdvvikgddesqqgirfnlfqlfstyygedarlnigpkgftgekyggatywdte
    afafpvylgitdpkvtrnllmyrykqldgayinaqeqglkgalfpmvtfdgiechnewei
    tfeeihrngdiafaiynytrytgddsyvlhegakvlteisrfwadrvhfskrnnqymihg
    vtgadeyennvdnnwdtnmlaqwtlkytleilgkvdqdtakqldvsdeektkwqdivdrm
    ylpydkdlnifvqhdgfldkdiepvssipadqrpinqnwswdkilrspyikqgdvlqgiw
    dfiddytpeqkkanfdfyepltvhesslspaihsvlaadlhyedkavelysrtarldldn
    ynndttdglhitsmtgawiavvqgfagmrvrdgqlhyapflpktwtsytfrqvfrdrlie
    vsvhadgphfkllsgepltidvagaaaaaaaaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h54B (B:)
    mkrifevqpwnvithtfdpkdkrlqesmtslgngymgmrgdfeegysgdslqgiylggvw
    ypdktrvgwwkngypkyfgkvvnavnfiklpieingepvdlakdkisdftldldmhqgvl
    nrsfvvergavrvalnfqrflsvaqpelsvqkvtvknlsdaevdvtlkpsidadvmneea
    nyderfwdvlatdqqadrgsivakttpnpfgtprftsgmemrlvtdlknvaitqpnekev
    ttaytgklapqasaelekrvivvtsrdydtqesltaamhqlsdkvaqssyedllnahtai
    waqrweksdvvikgddesqqgirfnlfqlfstyygedarlnigpkgftgekyggatywdt
    eafafpvylgitdpkvtrnllmyrykqldgayinaqeqglkgalfpmvtfdgiechnewe
    itfeeihrngdiafaiynytrytgddsyvlhegakvlteisrfwadrvhfskrnnqymih
    gvtgadeyennvdnnwdtnmlaqwtlkytleilgkvdqdtakqldvsdeektkwqdivdr
    mylpydkdlnifvqhdgfldkdiepvssipadqrpinqnwswdkilrspyikqgdvlqgi
    wdfiddytpeqkkanfdfyepltvhesslspaihsvlaadlhyedkavelysrtarldld
    nynndttdglhitsmtgawiavvqgfagmrvrdgqlhyapflpktwtsytfrqvfrdrli
    evsvhadgphfkllsgepltidvagaaaaaaaaa