PDB entry 1h53

View 1h53 on RCSB PDB site
Description: Binding of Phosphate and Pyrophosphate ions at the active site of human Angiogenin as revealed by X-ray Crystallography
Class: hydrolase
Keywords: angiogenin, ribonuclease, phosphate, pyrophosphate, hydrolase
Deposited on 2001-05-18, released 2001-08-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03950 (Start-122)
      • engineered mutation (116)
    Domains in SCOPe 2.06: d1h53a_
  • Heterogens: CIT, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1h53A (A:)
ednsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk
ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldgsif
rrp

    Sequence, based on observed residues (ATOM records): (download) 
    >1h53A (A:)
nsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenkng
nphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldgsifrr
p