PDB entry 1h53

View 1h53 on RCSB PDB site
Description: binding of phosphate and pyrophosphate ions at the active site of human angiogenin as revealed by x-ray crystallography
Deposited on 2001-05-18, released 2001-08-09
The last revision prior to the SCOP 1.61 freeze date was dated 2001-08-09, with a file datestamp of 2001-08-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1h53a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1h53A (A:)
  nsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenkng
  nphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldgsifrr
  p