PDB entry 1h50

View 1h50 on RCSB PDB site
Description: Structure of Pentaerythritol Tetranitrate Reductase and complexes
Class: oxidoreductase
Keywords: oxidoreductase, flavoenzyme, explosive degradation, steroid binding
Deposited on 2001-05-17, released 2001-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pentaerythritol tetranitrate reductase
    Species: Enterobacter cloacae [TaxId:550]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h50a_
  • Heterogens: FMN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h50A (A:)
    saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq
    isaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapv
    sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel
    hsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf
    qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga
    gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd
    ypsl