PDB entry 1h4w

View 1h4w on RCSB PDB site
Description: Structure of human trypsin IV (brain trypsin)
Class: hydrolase
Keywords: serine protease, signal transduction, inhibitor resistance, alzheimer disease, hydrolase
Deposited on 2001-05-15, released 2002-02-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsin iva
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35030 (0-223)
      • cloning artifact (67)
    Domains in SCOPe 2.08: d1h4wa_
  • Heterogens: BEN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h4wA (A:)
    ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
    neqfinavkiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
    wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdsggp
    vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans