PDB entry 1h4u

View 1h4u on RCSB PDB site
Description: domain g2 of mouse nidogen-1
Class: extracellular matrix protein
Keywords: extracellular matrix protein
Deposited on 2001-05-14, released 2001-06-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.241
AEROSPACI score: -1.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nidogen-1
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1h4ua1, d1h4ua2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h4uA (A:)
    csvhaecrdyatgfccrcvanytgngrqcvaegspqrvngkvkgrifvgssqvpvvfent
    dlhsyvvmnhgrsytaistipetvgysllplapiggiigwmfaveqdgfkngfsitggef
    trqaevtflghpgklvlkqqfsgidehghltistelegrvpqipygasvhiepytelyhy
    sssvitssstreytvmepdqdgaapshthiyqwrqtitfqecahddarpalpstqqlsvd
    svfvlynkeerilryalsnsigpvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4uA (A:)
    csvhaeccrcvanytgngrqcvaegspqrvngkvkgrifvgssqvpvvfentdlhsyvvm
    nhgrsytaistipetvgysllplapiggiigwmfaveqdgfkngfsitggeftrqaevtf
    lghpgklvlkqqfsgidehghltistelegrvpqipygasvhiepytelyhysssvitss
    streytvmeppshthiyqwrqtitfqecpalpstqqlsvdsvfvlynkeerilryalsns
    igpvr