PDB entry 1h4r

View 1h4r on RCSB PDB site
Description: crystal structure of the ferm domain of merlin, the neurofibromatosis 2 tumor suppressor protein.
Deposited on 2001-05-14, released 2002-01-16
The last revision prior to the SCOP 1.63 freeze date was dated 2002-02-28, with a file datestamp of 2002-02-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h4rA (A:)
    ktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmdk
    kvldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekiycppeasv
    llasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawyaehrgra
    rdeaemeylkiaqdlemygvnyfairnkkgtelllgvdalglhiydpenrltpkisfpwn
    eirnisysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrrka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h4rB (B:)
    ktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmdk
    kvldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekiycppeasv
    llasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawyaehrgra
    rdeaemeylkiaqdlemygvnyfairnkkgtelllgvdalglhiydpenrltpkisfpwn
    eirnisysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrrka