PDB entry 1h4p

View 1h4p on RCSB PDB site
Description: Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae
Class: hydrolase
Keywords: hydrolase, glucan degradation, hydrolyase, glycosidase
Deposited on 2001-05-11, released 2003-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucan 1,3-beta-glucosidase I/II
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23776 (0-407)
      • conflict (100)
      • conflict (164)
      • conflict (182)
      • conflict (289)
      • conflict (302)
    Domains in SCOPe 2.08: d1h4pa_
  • Chain 'B':
    Compound: glucan 1,3-beta-glucosidase I/II
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23776 (0-407)
      • conflict (100)
      • conflict (164)
      • conflict (182)
      • conflict (289)
      • conflict (302)
    Domains in SCOPe 2.08: d1h4pb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h4pA (A:)
    yydydhgslgepirgvniggwlllepyitpslfeafrtnddndegipvdeyhfcqylgkd
    laksrlqshwstfyqeqdfaniasqgfnlvripigywafqildddpyvsglqesyldqai
    gwarnnslkvwvdlhgaagsqngfdnsglrdsykfledsnlavtinvlnyilkkysaeey
    ldivigielineplgpvldmdkmkndylapayeylrnniksdqviiihdafqpynywddf
    mtendgywgvtidhhhyqvfasdqlersidehikvacewgtgvlneshwivcgefaaalt
    dcikwlnsvgfgarydgswvngdqtssyigscannddiaywsderkentrryveaqldaf
    emrggwiiwcyktesslewdaqrlmfnglfpqpltdrkypnqcgtisn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h4pB (B:)
    yydydhgslgepirgvniggwlllepyitpslfeafrtnddndegipvdeyhfcqylgkd
    laksrlqshwstfyqeqdfaniasqgfnlvripigywafqildddpyvsglqesyldqai
    gwarnnslkvwvdlhgaagsqngfdnsglrdsykfledsnlavtinvlnyilkkysaeey
    ldivigielineplgpvldmdkmkndylapayeylrnniksdqviiihdafqpynywddf
    mtendgywgvtidhhhyqvfasdqlersidehikvacewgtgvlneshwivcgefaaalt
    dcikwlnsvgfgarydgswvngdqtssyigscannddiaywsderkentrryveaqldaf
    emrggwiiwcyktesslewdaqrlmfnglfpqpltdrkypnqcgtisn