PDB entry 1h4m

View 1h4m on RCSB PDB site
Description: Sulfurtransferase from Azotobacter vinelandii in complex with phosphate
Class: transferase
Keywords: transferase, sulfur metabolism, thiosulfate:cyanide
Deposited on 2001-05-11, released 2002-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: putative thiosulfate sulfurtransferase
    Species: Azotobacter vinelandii [TaxId:354]
    Gene: RHDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1h4mx1, d1h4mx2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h4mX (X:)
    mddfaslplviepadlqarlsapelilvdltsaaryaeghipgarfvdpkrtqlgqppap
    glqppreqleslfgelghrpeavyvvyddegggwagrfiwlldvigqqryhylnggltaw
    laedrplsrelpapaggpvalslhdeptasrdyllgrlgaadlaiwdarspqeyrgekvl
    aakgghipgavnfewtaamdpsralrirtdiagrleelgitpdkeivthcqthhrsglty
    liakalgyprvkgyagswgewgnhpdtpvel