PDB entry 1h4l

View 1h4l on RCSB PDB site
Description: structure and regulation of the cdk5-p25(nck5a) complex
Deposited on 2001-05-11, released 2002-08-14
The last revision prior to the SCOP 1.65 freeze date was dated 2002-08-14, with a file datestamp of 2002-08-14.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.236
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1h4la_
  • Chain 'B':
    Domains in SCOP 1.65: d1h4lb_
  • Chain 'D':
    Domains in SCOP 1.65: d1h4ld_
  • Chain 'E':
    Domains in SCOP 1.65: d1h4le_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h4lA (A:)
    mqkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkh
    knivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsr
    nvlhrdlkpqnllinrngelkladfglarafgipvrcysaevvtlwyrppdvlfgaklys
    tsidmwsagcifaelanaarplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpyp
    mypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdfcpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4lA (A:)
    qkyeklekiygtvfkaknretheivalkrvrldgvpssalreicllkelkhknivrlhdv
    lhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrnvlhrdlkp
    qnllinrngelkladfglarafgipvrcysaevvtlwyrppdvlfgaklystsidmwsag
    cifaelanaarplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypmypattslv
    nvvpklnatgrdllqnllkcnpvqrisaeealqhpyfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h4lB (B:)
    mqkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkh
    knivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsr
    nvlhrdlkpqnllinrngelkladfglarafgipvrcysaevvtlwyrppdvlfgaklys
    tsidmwsagcifaelanaarplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpyp
    mypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdfcpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4lB (B:)
    qkyeklekiygtvfkaknretheivalkrvrldgvpssalreicllkelkhknivrlhdv
    lhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrnvlhrdlkp
    qnllinrngelkladfglarafgipvrcysaevvtlwyrppdvlfgaklystsidmwsag
    cifaelanaarplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypmypattslv
    nvvpklnatgrdllqnllkcnpvqrisaeealqhpyfs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h4lD (D:)
    stsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflym
    lcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsvin
    lmsskmlqinadphyftqvfsdlknes
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h4lE (E:)
    stsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflym
    lcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsvin
    lmsskmlqinadphyftqvfsdlknes