PDB entry 1h4j

View 1h4j on RCSB PDB site
Description: methylobacterium extorquens methanol dehydrogenase d303e mutant
Class: oxidoreductase
Keywords: oxidoreductase, dehydrogenase, quinoprotein
Deposited on 2001-05-11, released 2001-08-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.187
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methanol dehydrogenase subunit 1
    Species: METHYLOBACTERIUM EXTORQUENS [TaxId:408]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16027 (0-End)
      • engineered mutation (302)
    Domains in SCOPe 2.05: d1h4ja_
  • Chain 'B':
    Compound: methanol dehydrogenase subunit 2
    Species: METHYLOBACTERIUM EXTORQUENS [TaxId:408]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1h4jb_
  • Chain 'C':
    Compound: methanol dehydrogenase subunit 1
    Species: METHYLOBACTERIUM EXTORQUENS [TaxId:408]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16027 (0-End)
      • engineered mutation (302)
    Domains in SCOPe 2.05: d1h4jc_
  • Chain 'D':
    Compound: methanol dehydrogenase subunit 2
    Species: METHYLOBACTERIUM EXTORQUENS [TaxId:408]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1h4jd_
  • Chain 'E':
    Compound: methanol dehydrogenase subunit 1
    Species: METHYLOBACTERIUM EXTORQUENS [TaxId:408]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16027 (0-End)
      • engineered mutation (302)
    Domains in SCOPe 2.05: d1h4je_
  • Chain 'F':
    Compound: methanol dehydrogenase subunit 2
    Species: METHYLOBACTERIUM EXTORQUENS [TaxId:408]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1h4jf_
  • Chain 'G':
    Compound: methanol dehydrogenase subunit 1
    Species: METHYLOBACTERIUM EXTORQUENS [TaxId:408]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16027 (0-End)
      • engineered mutation (302)
    Domains in SCOPe 2.05: d1h4jg_
  • Chain 'H':
    Compound: methanol dehydrogenase subunit 2
    Species: METHYLOBACTERIUM EXTORQUENS [TaxId:408]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1h4jh_
  • Heterogens: PQQ, CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h4jA (A:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    eweyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewksaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4jA (A:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    eweyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h4jB (B:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakisan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4jB (B:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakis
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1h4jC (C:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    eweyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewksaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4jC (C:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    eweyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1h4jD (D:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakisan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4jD (D:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakis
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1h4jE (E:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    eweyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewksaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4jE (E:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    eweyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1h4jF (F:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakisan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4jF (F:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakis
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1h4jG (G:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    eweyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewksaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4jG (G:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    eweyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1h4jH (H:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakisan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4jH (H:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakis