PDB entry 1h4b

View 1h4b on RCSB PDB site
Description: solution structure of the birch pollen allergen bet v 4
Class: allergen
Keywords: allergen, birch pollen allergen, calcium-binding polcalcin, heteronuclear nmr, structure
Deposited on 2003-02-26, released 2004-02-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polcalcin bet v 4
    Species: BETULA VERRUCOSA [TaxId:3505]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1h4ba_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h4bA (A:)
    addhpqdkaererifkrfdangdgkisaaelgealktlgsitpdevkhmmaeidtdgdgf
    isfqeftdfgranrgllkdvakif