PDB entry 1h4b

View 1h4b on RCSB PDB site
Description: solution structure of the birch pollen allergen bet v 4
Deposited on 2003-02-26, released 2004-02-26
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-18, with a file datestamp of 2004-03-18.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1h4ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h4bA (A:)
    addhpqdkaererifkrfdangdgkisaaelgealktlgsitpdevkhmmaeidtdgdgf
    isfqeftdfgranrgllkdvakif