PDB entry 1h4a

View 1h4a on RCSB PDB site
Description: human gammad crystallin r58h mutant structure at 1.15 a resolution
Deposited on 2003-02-25, released 2003-05-08
The last revision prior to the SCOP 1.69 freeze date was dated 2003-05-08, with a file datestamp of 2003-05-08.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.157
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h4aX (X:)
gkitlyedrgfqgrhyecssdhpnlqpylsrcnsarvdsgcwmlyeqpnysglqyflhrg
dyadhqqwmglsdsvrscrliphsgshrirlyeredyrgqmieftedcsclqdrfrfnei
hslnvlegswvlyelsnyrgrqyllmpgdyrryqdwgatnarvgslrrvidfs