PDB entry 1h49

View 1h49 on RCSB PDB site
Description: crystal structure of the inactive double mutant of the maize beta- glucosidase zmglu1-e191d-f198v in complex with dimboa-glucoside
Deposited on 2003-02-25, released 2003-03-11
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-03, with a file datestamp of 2003-07-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18541
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1h49a_
  • Chain 'B':
    Domains in SCOP 1.65: d1h49b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h49A (A:)
    sarvgsqngvqmlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnh
    perildgsnsdigansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgik
    yyrnlinlllengiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfg
    dkvknwltfndpqtftsvsygtgvfapgrcspgldcayptgnslvepytaghnillahae
    avdlynkhykrddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypf
    smrslarerlpffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasq
    evngpdgkpigppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplp
    meaalndykrldyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdr
    nnnctrymkesakwlkefntakkpskkiltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h49A (A:)
    mlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsnsd
    igansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinllle
    ngiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltfnd
    pqtftsvsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhykr
    ddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarerlp
    ffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkpig
    ppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndykrl
    dyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymkes
    akwlkefntak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h49B (B:)
    sarvgsqngvqmlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnh
    perildgsnsdigansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgik
    yyrnlinlllengiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfg
    dkvknwltfndpqtftsvsygtgvfapgrcspgldcayptgnslvepytaghnillahae
    avdlynkhykrddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypf
    smrslarerlpffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasq
    evngpdgkpigppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplp
    meaalndykrldyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdr
    nnnctrymkesakwlkefntakkpskkiltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h49B (B:)
    mlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsnsd
    igansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinllle
    ngiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltfnd
    pqtftsvsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhykr
    ddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarerlp
    ffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkpig
    ppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndykrl
    dyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymkes
    akwlkefntak