PDB entry 1h48

View 1h48 on RCSB PDB site
Description: the structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase in complex with cmp and product
Class: synthase
Keywords: synthase, isoprenoid, lyase, isoprene biosynthesis
Deposited on 2003-02-24, released 2004-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1H48 (Start-1)
    • Uniprot P36663 (2-End)
    Domains in SCOPe 2.06: d1h48a1, d1h48a2
  • Chain 'B':
    Compound: 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1H48 (0-1)
    • Uniprot P36663 (2-End)
    Domains in SCOPe 2.06: d1h48b1, d1h48b2
  • Chain 'C':
    Compound: 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1H48 (0-1)
    • Uniprot P36663 (2-End)
    Domains in SCOPe 2.06: d1h48c1, d1h48c2
  • Chain 'D':
    Compound: 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1H48 (0-1)
    • Uniprot P36663 (2-End)
    Domains in SCOPe 2.06: d1h48d1, d1h48d2
  • Chain 'E':
    Compound: 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1H48 (Start-1)
    • Uniprot P36663 (2-End)
    Domains in SCOPe 2.06: d1h48e1, d1h48e2
  • Chain 'F':
    Compound: 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1H48 (0-1)
    • Uniprot P36663 (2-End)
    Domains in SCOPe 2.06: d1h48f1, d1h48f2
  • Heterogens: CDI, ZN, C5P, MN, GPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h48A (A:)
    lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h48A (A:)
    emrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigk
    lfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaed
    lgchmddvnvkattteklgftgrgegiaceavallik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h48B (B:)
    lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h48B (B:)
    lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgrgegiaceavallik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1h48C (C:)
    lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h48C (C:)
    lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgrgegiaceavallika
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1h48D (D:)
    lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h48D (D:)
    lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgrgegiaceavallik
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1h48E (E:)
    lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h48E (E:)
    emrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigk
    lfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaed
    lgchmddvnvkattteklgftgrgegiaceavallik
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1h48F (F:)
    lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h48F (F:)
    lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgrgegiaceavallika