PDB entry 1h47

View 1h47 on RCSB PDB site
Description: structures of mecp synthase in complex with (I) cmp and (II) cmp and product
Class: synthase
Keywords: synthase, isoprenoid, lyase, isoprene biosynthesis
Deposited on 2003-02-24, released 2004-10-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H47 (Start-1)
    • Uniprot P62617 (2-End)
    Domains in SCOPe 2.06: d1h47a1, d1h47a2
  • Chain 'B':
    Compound: 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H47 (0-1)
    • Uniprot P62617 (2-End)
    Domains in SCOPe 2.06: d1h47b1, d1h47b2
  • Chain 'C':
    Compound: 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H47 (Start-1)
    • Uniprot P62617 (2-End)
    Domains in SCOPe 2.06: d1h47c1, d1h47c2
  • Chain 'D':
    Compound: 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H47 (Start-1)
    • Uniprot P62617 (2-End)
    Domains in SCOPe 2.06: d1h47d1, d1h47d2
  • Chain 'E':
    Compound: 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H47 (0-1)
    • Uniprot P62617 (2-End)
    Domains in SCOPe 2.06: d1h47e1, d1h47e2
  • Chain 'F':
    Compound: 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H47 (Start-1)
    • Uniprot P62617 (2-End)
    Domains in SCOPe 2.06: d1h47f1, d1h47f2
  • Heterogens: GPP, ZN, C5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h47A (A:)
    lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h47A (A:)
    emrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigk
    lfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaed
    lgchmddvnvkattteklgftgrgegiaceavallik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h47B (B:)
    lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h47B (B:)
    lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgrgegiaceavallik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1h47C (C:)
    lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h47C (C:)
    emrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigk
    lfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaed
    lgchmddvnvkattteklgftgrgegiaceavallik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1h47D (D:)
    lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h47D (D:)
    emrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigk
    lfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaed
    lgchmddvnvkattteklgftgrgegiaceavallik
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1h47E (E:)
    lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h47E (E:)
    lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgrgegiaceavallik
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1h47F (F:)
    lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h47F (F:)
    emrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigk
    lfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaed
    lgchmddvnvkattteklgftgrgegiaceavallik