PDB entry 1h41

View 1h41 on RCSB PDB site
Description: pseudomonas cellulosa e292a alpha-d-glucuronidase mutant complexed with aldotriuronic acid
Deposited on 2002-09-25, released 2003-05-01
The last revision prior to the SCOP 1.67 freeze date was dated 2003-05-01, with a file datestamp of 2003-05-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.11801
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h41A (A:)
    edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
    deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
    lygsfhllrliqtqhaleklslssaprlqhrvvnhwdnlnrvvergyaglslwdwgslpn
    ylaprytdyarinaslgingtvinnvnadprvlsdqflqkiaaladafrpygikmylsin
    fnsprafgdvdtadpldprvqqwwktraqkiysyipdfggflvkadsagqpgpqgygrdh
    aeganmlaaalkpfggvvfwrafvyhpdiedrfrgaydefmpldgkfadnvilqikngpi
    dfqprepfsalfagmsrtnmmmefqitqeyfgfathlayqgplfeeslktethargegst
    ignilegkvfktrhtgmagvinpgtdrnwtghpfvqsswyafgrmawdhqisaataadew
    lrmtfsnqpafiepvkqmmlvsreagvnyrsplglthlysqgdhygpapwtddlpradwt
    avyyhrasktgigfnrtktgsnalaqypepiakawgdlnsvpedlilwfhhlswdhrmqs
    grnlwqelvhkyyqgveqvramqrtwdqqeayvdaarfaqvkallqvqereavrwrnscv
    lyfqsvagrpipanyeqpehdleyykmlarttyvpepwhpasssrvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h41A (A:)
    edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
    deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
    lygsfhllrliqtqhaleklslssaprlqhrvvnhwdnlnrvvergyaglslwdwgslpn
    ylaprytdyarinaslgingtvinnvnadprvlsdqflqkiaaladafrpygikmylsin
    fnsprafgdvdtadpldprvqqwwktraqkiysyipdfggflvkadsagqpgpqgygrdh
    aeganmlaaalkpfggvvfwradrfrgaydefmpldgkfadnvilqikngpidfqprepf
    salfagmsrtnmmmefqitqeyfgfathlayqgplfeeslktethargegstignilegk
    vfktrhtgmagvinpgtdrnwtghpfvqsswyafgrmawdhqisaataadewlrmtfsnq
    pafiepvkqmmlvsreagvnyrsplglthlysqgdhygpapwtddlpradwtavyyhras
    ktgigfnrtktgsnalaqypepiakawgdlnsvpedlilwfhhlswdhrmqsgrnlwqel
    vhkyyqgveqvramqrtwdqqeayvdaarfaqvkallqvqereavrwrnscvlyfqsvag
    rpipanyeqpehdleyykmlarttyvpepwhpasssrvlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h41B (B:)
    edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
    deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
    lygsfhllrliqtqhaleklslssaprlqhrvvnhwdnlnrvvergyaglslwdwgslpn
    ylaprytdyarinaslgingtvinnvnadprvlsdqflqkiaaladafrpygikmylsin
    fnsprafgdvdtadpldprvqqwwktraqkiysyipdfggflvkadsagqpgpqgygrdh
    aeganmlaaalkpfggvvfwrafvyhpdiedrfrgaydefmpldgkfadnvilqikngpi
    dfqprepfsalfagmsrtnmmmefqitqeyfgfathlayqgplfeeslktethargegst
    ignilegkvfktrhtgmagvinpgtdrnwtghpfvqsswyafgrmawdhqisaataadew
    lrmtfsnqpafiepvkqmmlvsreagvnyrsplglthlysqgdhygpapwtddlpradwt
    avyyhrasktgigfnrtktgsnalaqypepiakawgdlnsvpedlilwfhhlswdhrmqs
    grnlwqelvhkyyqgveqvramqrtwdqqeayvdaarfaqvkallqvqereavrwrnscv
    lyfqsvagrpipanyeqpehdleyykmlarttyvpepwhpasssrvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h41B (B:)
    edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
    deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
    lygsfhllrliqtqhaleklslssaprlqhrvvnhwdnlnrvvergyaglslwdwgslpn
    ylaprytdyarinaslgingtvinnvnadprvlsdqflqkiaaladafrpygikmylsin
    fnsprafgdvdtadpldprvqqwwktraqkiysyipdfggflvkadsagqpgpqgygrdh
    aeganmlaaalkpfggvvfwraedrfrgaydefmpldgkfadnvilqikngpidfqprep
    fsalfagmsrtnmmmefqitqeyfgfathlayqgplfeeslktethargegstignileg
    kvfktrhtgmagvinpgtdrnwtghpfvqsswyafgrmawdhqisaataadewlrmtfsn
    qpafiepvkqmmlvsreagvnyrsplglthlysqgdhygpapwtddlpradwtavyyhra
    sktgigfnrtktgsnalaqypepiakawgdlnsvpedlilwfhhlswdhrmqsgrnlwqe
    lvhkyyqgveqvramqrtwdqqeayvdaarfaqvkallqvqereavrwrnscvlyfqsva
    grpipanyeqpehdleyykmlarttyvpepwhpasssrvlk