PDB entry 1h41

View 1h41 on RCSB PDB site
Description: Pseudomonas cellulosa E292A alpha-D-glucuronidase mutant complexed with aldotriuronic acid
Class: hydrolase
Keywords: hydrolase, glucuronidase, (alpha-beta)8 barrel, glycoside hydrolase, glucuronic acid
Deposited on 2002-09-25, released 2003-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-glucuronidase
    Species: PSEUDOMONAS CELLULOSA [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VP74 (0-707)
      • engineered mutation (287)
    Domains in SCOPe 2.08: d1h41a1, d1h41a2
  • Chain 'B':
    Compound: alpha-glucuronidase
    Species: PSEUDOMONAS CELLULOSA [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VP74 (0-707)
      • engineered mutation (287)
    Domains in SCOPe 2.08: d1h41b1, d1h41b2
  • Heterogens: GCV, EDO, CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h41A (A:)
    edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
    deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
    lygsfhllrliqtqhaleklslssaprlqhrvvnhwdnlnrvvergyaglslwdwgslpn
    ylaprytdyarinaslgingtvinnvnadprvlsdqflqkiaaladafrpygikmylsin
    fnsprafgdvdtadpldprvqqwwktraqkiysyipdfggflvkadsagqpgpqgygrdh
    aeganmlaaalkpfggvvfwrafvyhpdiedrfrgaydefmpldgkfadnvilqikngpi
    dfqprepfsalfagmsrtnmmmefqitqeyfgfathlayqgplfeeslktethargegst
    ignilegkvfktrhtgmagvinpgtdrnwtghpfvqsswyafgrmawdhqisaataadew
    lrmtfsnqpafiepvkqmmlvsreagvnyrsplglthlysqgdhygpapwtddlpradwt
    avyyhrasktgigfnrtktgsnalaqypepiakawgdlnsvpedlilwfhhlswdhrmqs
    grnlwqelvhkyyqgveqvramqrtwdqqeayvdaarfaqvkallqvqereavrwrnscv
    lyfqsvagrpipanyeqpehdleyykmlarttyvpepwhpasssrvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h41A (A:)
    edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
    deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
    lygsfhllrliqtqhaleklslssaprlqhrvvnhwdnlnrvvergyaglslwdwgslpn
    ylaprytdyarinaslgingtvinnvnadprvlsdqflqkiaaladafrpygikmylsin
    fnsprafgdvdtadpldprvqqwwktraqkiysyipdfggflvkadsagqpgpqgygrdh
    aeganmlaaalkpfggvvfwradrfrgaydefmpldgkfadnvilqikngpidfqprepf
    salfagmsrtnmmmefqitqeyfgfathlayqgplfeeslktethargegstignilegk
    vfktrhtgmagvinpgtdrnwtghpfvqsswyafgrmawdhqisaataadewlrmtfsnq
    pafiepvkqmmlvsreagvnyrsplglthlysqgdhygpapwtddlpradwtavyyhras
    ktgigfnrtktgsnalaqypepiakawgdlnsvpedlilwfhhlswdhrmqsgrnlwqel
    vhkyyqgveqvramqrtwdqqeayvdaarfaqvkallqvqereavrwrnscvlyfqsvag
    rpipanyeqpehdleyykmlarttyvpepwhpasssrvlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h41B (B:)
    edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
    deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
    lygsfhllrliqtqhaleklslssaprlqhrvvnhwdnlnrvvergyaglslwdwgslpn
    ylaprytdyarinaslgingtvinnvnadprvlsdqflqkiaaladafrpygikmylsin
    fnsprafgdvdtadpldprvqqwwktraqkiysyipdfggflvkadsagqpgpqgygrdh
    aeganmlaaalkpfggvvfwrafvyhpdiedrfrgaydefmpldgkfadnvilqikngpi
    dfqprepfsalfagmsrtnmmmefqitqeyfgfathlayqgplfeeslktethargegst
    ignilegkvfktrhtgmagvinpgtdrnwtghpfvqsswyafgrmawdhqisaataadew
    lrmtfsnqpafiepvkqmmlvsreagvnyrsplglthlysqgdhygpapwtddlpradwt
    avyyhrasktgigfnrtktgsnalaqypepiakawgdlnsvpedlilwfhhlswdhrmqs
    grnlwqelvhkyyqgveqvramqrtwdqqeayvdaarfaqvkallqvqereavrwrnscv
    lyfqsvagrpipanyeqpehdleyykmlarttyvpepwhpasssrvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h41B (B:)
    edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
    deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
    lygsfhllrliqtqhaleklslssaprlqhrvvnhwdnlnrvvergyaglslwdwgslpn
    ylaprytdyarinaslgingtvinnvnadprvlsdqflqkiaaladafrpygikmylsin
    fnsprafgdvdtadpldprvqqwwktraqkiysyipdfggflvkadsagqpgpqgygrdh
    aeganmlaaalkpfggvvfwraedrfrgaydefmpldgkfadnvilqikngpidfqprep
    fsalfagmsrtnmmmefqitqeyfgfathlayqgplfeeslktethargegstignileg
    kvfktrhtgmagvinpgtdrnwtghpfvqsswyafgrmawdhqisaataadewlrmtfsn
    qpafiepvkqmmlvsreagvnyrsplglthlysqgdhygpapwtddlpradwtavyyhra
    sktgigfnrtktgsnalaqypepiakawgdlnsvpedlilwfhhlswdhrmqsgrnlwqe
    lvhkyyqgveqvramqrtwdqqeayvdaarfaqvkallqvqereavrwrnscvlyfqsva
    grpipanyeqpehdleyykmlarttyvpepwhpasssrvlk