PDB entry 1h3x

View 1h3x on RCSB PDB site
Description: crystal structure of the human igg1 fc-fragment,glycoform (g0f)2
Class: immune system
Keywords: immunoglobin/fc-fragment, fc-fragment, glycosylation, fcgr, antibody, effector functions, immune system
Deposited on 2002-09-19, released 2003-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.278
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H3X
    Domains in SCOPe 2.06: d1h3xa1, d1h3xa2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H3X
    Domains in SCOPe 2.06: d1h3xb1, d1h3xb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h3xA (A:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqv
    hnaktkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqpr
    epqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3xA (A:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslslsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h3xB (B:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqv
    hnaktkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqpr
    epqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3xB (B:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsls