PDB entry 1h3t

View 1h3t on RCSB PDB site
Description: crystal structure of the human igg1 fc-fragment,glycoform (mn2f)2
Class: immune system
Keywords: immunoglobulin, immune system, glycosylation, fcgr, antibody, effector functions
Deposited on 2002-09-19, released 2003-01-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.28
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H3T
    Domains in SCOPe 2.06: d1h3ta1, d1h3ta2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H3T
    Domains in SCOPe 2.06: d1h3tb1, d1h3tb2
  • Heterogens: BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h3tA (A:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqv
    hnaktkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqpr
    epqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3tA (A:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslslsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h3tB (B:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqv
    hnaktkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqpr
    epqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3tB (B:)
    psvflfppkpkdtlmisrtpevtcvvvdvshqkfnwyvdgvqvhnaktkpreqqnstyrv
    vsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsreemtknq
    vsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnv
    fscsvmhealhnhytqkslsls