PDB entry 1h3q

View 1h3q on RCSB PDB site
Description: crystal sturcture of sedl at 2.4 angstroms resolution
Deposited on 2002-09-16, released 2002-10-15
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-04, with a file datestamp of 2003-02-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1h3qa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h3qA (A:)
    msgsfyfvivghhdnpvfemeflppgkaeskddhrhlnqfiahaaldlvdenmwlsnnmy
    lktvdkfnewfvsafvtaghmrfimlhdvrqedgiknfftdvydlyikfamnpfyepnsp
    irssafdrkvqflgkkhlls