PDB entry 1h3q

View 1h3q on RCSB PDB site
Description: crystal sturcture of sedl at 2.4 angstroms resolution
Class: transport
Keywords: transport, sedl, sedt, endoplasmic reticulum, golgi, vesicle transport
Deposited on 2002-09-16, released 2002-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sedlin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1h3qa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h3qA (A:)
    msgsfyfvivghhdnpvfemeflppgkaeskddhrhlnqfiahaaldlvdenmwlsnnmy
    lktvdkfnewfvsafvtaghmrfimlhdvrqedgiknfftdvydlyikfamnpfyepnsp
    irssafdrkvqflgkkhlls