PDB entry 1h3p

View 1h3p on RCSB PDB site
Description: structural characterisation of a monoclonal antibody specific for the pres1 region of the hepatitis b virus
Deposited on 2002-09-12, released 2002-09-19
The last revision prior to the SCOP 1.69 freeze date was dated 2002-09-19, with a file datestamp of 2002-09-19.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2126
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1h3pH (H:)
    evqlvesggglvkpggslklscaasgftfssyamswvrqspekrlewvaevssdgsyayy
    pdtltgrftisrdnakntlylemtslrsedtamyycasfnwdvaywgqgtlvtvsaaktt
    ppsvyplapgslaqtnsmvtlgclvkgyfpepvtvtwnsgslsssgvhtfpavlqsdlyt
    lsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3pH (H:)
    evqlvesggglvkpggslklscaasgftfssyamswvrqspekrlewvaevssdgsyayy
    pdtltgrftisrdnakntlylemtslrsedtamyycasfnwdvaywgqgtlvtvsaaktt
    ppsvyplapgsnsmvtlgclvkgyfpepvtvtwnsgslsssgvhtfpavlqsdlytlsss
    vtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1h3pL (L:)
    divmtqspsslavsvgekvtmscrssqsllntrtrksylawfqqkpgqspkmliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsyslytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnecevqlvesggglvkpggslkls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3pL (L:)
    divmtqspsslavsvgekvtmscrssqsllntrtrksylawfqqkpgqspkmliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsyslytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnece