PDB entry 1h3o

View 1h3o on RCSB PDB site
Description: crystal structure of the human taf4-taf12 (tafii135-tafii20) complex
Deposited on 2002-09-12, released 2002-09-26
The last revision prior to the SCOP 1.63 freeze date was dated 2002-09-26, with a file datestamp of 2002-09-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.226
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1h3oa_
  • Chain 'B':
    Domains in SCOP 1.63: d1h3ob_
  • Chain 'C':
    Domains in SCOP 1.63: d1h3oc_
  • Chain 'D':
    Domains in SCOP 1.63: d1h3od_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h3oA (A:)
    mfllqaplqrrileigkkhgitelhpdvvsyvshatqqrlqnlvekiset
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h3oB (B:)
    hmvltkkklqdlvrevdpneqldedveemllqiaddfiesvvtaacqlarhrksstlevk
    dvqlhlerqwnmwi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h3oC (C:)
    mfllqaplqrrileigkkhgitelhpdvvsyvshatqqrlqnlvekiset
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h3oD (D:)
    hmvltkkklqdlvrevdpneqldedveemllqiaddfiesvvtaacqlarhrksstlevk
    dvqlhlerqwnmwi