PDB entry 1h3l

View 1h3l on RCSB PDB site
Description: N-terminal fragment of SigR from Streptomyces coelicolor
Class: transcription
Keywords: transcription, DNA-binding, transcription regulation
Deposited on 2002-09-10, released 2002-10-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: N/A
AEROSPACI score: -1.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase sigma factor
    Species: STREPTOMYCES COELICOLOR A3(2) [TaxId:100226]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1h3la_
  • Chain 'B':
    Compound: RNA polymerase sigma factor
    Species: STREPTOMYCES COELICOLOR A3(2) [TaxId:100226]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1h3lb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h3lA (A:)
    gtgaestaersarferdalefldqmysaalrmtrnpadaedlvqetyakayasfhqfreg
    tnlkawlyriltntfinsyrkkqrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3lA (A:)
    staersarferdalefldqmysaalrmtrnpadaedlvqetyakayasfhqfregtnlka
    wlyriltntfinsyr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h3lB (B:)
    gtgaestaersarferdalefldqmysaalrmtrnpadaedlvqetyakayasfhqfreg
    tnlkawlyriltntfinsyrkkqrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3lB (B:)
    gaestaersarferdalefldqmysaalrmtrnpadaedlvqetyakayasfhqfregtn
    lkawlyriltntfinsyr