PDB entry 1h3l

View 1h3l on RCSB PDB site
Description: n-terminal fragment of sigr from streptomyces coelicolor
Deposited on 2002-09-10, released 2002-10-03
The last revision prior to the SCOP 1.63 freeze date was dated 2002-10-03, with a file datestamp of 2002-10-03.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.25939
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1h3la_
  • Chain 'B':
    Domains in SCOP 1.63: d1h3lb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h3lA (A:)
    staersarferdalefldqmysaalrmtrnpadaedlvqetyakayasfhqfregtnlka
    wlyriltntfinsyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h3lB (B:)
    gaestaersarferdalefldqmysaalrmtrnpadaedlvqetyakayasfhqfregtn
    lkawlyriltntfinsyr