PDB entry 1h3j

View 1h3j on RCSB PDB site
Description: structure of recombinant coprinus cinereus peroxidase determined to 2.0 a
Deposited on 2002-09-05, released 2003-06-12
The last revision prior to the SCOP 1.71 freeze date was dated 2003-06-12, with a file datestamp of 2003-06-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1h3ja_
  • Chain 'B':
    Domains in SCOP 1.71: d1h3jb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h3jA (A:)
    gpggggsvtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfs
    paltaagqfggggadgsiiahsnielafpanggltdtvealravginhgvsfgdliqfat
    avgmsncpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdlla
    ahslasqeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefr
    mrsdallardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavs
    nnaapvipggltvddievscpsepfpeiatasgplpslapap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3jA (A:)
    svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
    gqfggggadgsiiahsnielafpanggltdtvealravginhgvsfgdliqfatavgmsn
    cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
    qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
    lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
    ipggltvddievscpsepfpeiatasgplpslapap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h3jB (B:)
    gpggggsvtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfs
    paltaagqfggggadgsiiahsnielafpanggltdtvealravginhgvsfgdliqfat
    avgmsncpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdlla
    ahslasqeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefr
    mrsdallardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavs
    nnaapvipggltvddievscpsepfpeiatasgplpslapap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3jB (B:)
    svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
    gqfggggadgsiiahsnielafpanggltdtvealravginhgvsfgdliqfatavgmsn
    cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
    qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
    lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
    ipggltvddievscpsepfpeiatasgplpslapap